PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_020849-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family MYB
Protein Properties Length: 310aa    MW: 33574.7 Da    PI: 7.911
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_020849-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding61.22.2e-192368147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W++eEde l  +v+++G+++W++I++ ++ gR++k+c++rw + 
  AHYPO_020849-RA 23 KGPWSAEEDEALTTLVQKHGPRNWSLISKSIP-GRSGKSCRLRWCNQ 68
                     79******************************.***********985 PP

2Myb_DNA-binding53.27e-1777119347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++T eEd+ +++a++++G++ W+tIar +  gRt++ +k++w++ 
  AHYPO_020849-RA  77 AFTSEEDDTIIRAHAKFGNK-WATIARLLS-GRTDNAIKNHWNST 119
                      79******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.1151873IPR017930Myb domain
SuperFamilySSF466895.08E-3220116IPR009057Homeodomain-like
SMARTSM007172.4E-172271IPR001005SANT/Myb domain
PfamPF002491.6E-182368IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.3E-262476IPR009057Homeodomain-like
CDDcd001671.33E-162567No hitNo description
SMARTSM007175.2E-1474122IPR001005SANT/Myb domain
PROSITE profilePS5129420.60675124IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.9E-2377123IPR009057Homeodomain-like
PfamPF002494.3E-1477119IPR001005SANT/Myb domain
CDDcd001672.03E-1177120No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MFRNGADKTN STQMNRKEVD RIKGPWSAEE DEALTTLVQK HGPRNWSLIS KSIPGRSGKS  60
CRLRWCNQLS PQVEHRAFTS EEDDTIIRAH AKFGNKWATI ARLLSGRTDN AIKNHWNSTL  120
KRKCSAMVCP APEDFSGDFP HPPPLKRAMS DGADVILKNV SGLSLNNNSN NNPGSPGSSD  180
ASDSGSYIFR PVATPGSVNI GSAPVFPPMT DLSLSLPGSD SFEVANSDPE PKTTMVGSEI  240
QVSPINSHFS QEFLAVMQDM IRKEVRTYME GLEMSNNGIG AFNNGGFCSQ AADGVMRAAM  300
TRIGIGKIE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A2e-41221243105MYB PROTO-ONCOGENE PROTEIN
1h88_C9e-412212457159MYB PROTO-ONCOGENE PROTEIN
1h89_C9e-412212457159MYB PROTO-ONCOGENE PROTEIN
1mse_C2e-41221243105C-Myb DNA-Binding Domain
1msf_C2e-41221243105C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010679545.11e-134PREDICTED: transcription factor MYB44
SwissprotQ9FDW15e-78MYB44_ARATH; Transcription factor MYB44
TrEMBLA0A0K9R0E41e-148A0A0K9R0E4_SPIOL; Uncharacterized protein
STRINGVIT_07s0129g01050.t011e-110(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G23290.11e-79myb domain protein 70